PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI05G16220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 318aa    MW: 34352.6 Da    PI: 7.0058
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI05G16220.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.27.6e-084286244
                     SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     g+W++eE + + +a + l  +   +W+++a  ++ g+t  ++  ++
  OMERI05G16220.1 42 GAWSQEENKVFEQALAALDRNdpeRWERVALLLP-GKTVADVMTHY 86
                     79*****************99*************.********999 PP

2Myb_DNA-binding45.61.6e-14156200347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G g+W+ I+r + + Rt+ q+ s+ qky
  OMERI05G16220.1 156 PWTEEEHKLFLMGLKKYGRGDWRNISRNFVTSRTPTQVASHAQKY 200
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007178.8E-74092IPR001005SANT/Myb domain
PfamPF002491.8E-54286IPR001005SANT/Myb domain
SuperFamilySSF466892.3E-94297IPR009057Homeodomain-like
PROSITE profilePS500906.2494290IPR017877Myb-like domain
CDDcd001675.09E-64386No hitNo description
PROSITE profilePS5129417.568149205IPR017930Myb domain
SuperFamilySSF466891.44E-17151205IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-17152203IPR006447Myb domain, plants
SMARTSM007175.8E-13153203IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-12153199IPR009057Homeodomain-like
PfamPF002497.5E-12156200IPR001005SANT/Myb domain
CDDcd001672.18E-11156201No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MMKESYMEVL PPAPAHYFVG QAAAAAAAGG WFLPDRRGGG GGAWSQEENK VFEQALAALD  60
RNDPERWERV ALLLPGKTVA DVMTHYDDLE NDVCFIEAGL VPFPHYGGGG SPSSAGFTLD  120
WDGGDDPAGL GFKRSCYMVG GKRARGPDQE RKKGVPWTEE EHKLFLMGLK KYGRGDWRNI  180
SRNFVTSRTP TQVASHAQKY FIRLNSGGKD KRRSSIHDIT TVNLPDDDHG NPSPSPPPSV  240
LTAHSSSSAT AVSEQFGVLV DGKPPPPLGR GAGHHHFMPH PYAQVKIEAG NSHVAGGGRL  300
DDSVLMQMQC GQLMQPLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1539110677RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0681380.0AK068138.1 Oryza sativa Japonica Group cDNA clone:J013135D01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637475.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H73e-82DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0E0DS940.0A0A0E0DS94_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g37730.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.14e-81MYB family protein